Overview

  • Product nameHuman ACOX1 full length protein
  • DescriptionHuman ACOX1 full length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15067
    • SpeciesHuman
    • SequenceMNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHED LNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPL DLHLGMFLPTLLHQATAEQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGL ETIATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCY GLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPRE NMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA IRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKE TYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHG YSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCG MVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAK NLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKA IQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIR SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY KHLKSLQSKL
    • Molecular weight99 kDa including tags
    • Amino acids1 to 660

Specifications

Our Abpromise guarantee covers the use of ab114556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ACOX1
    • ACOX1_HUMAN
    • AOX
    • EC 1.3.3.6
    • Palmitoyl CoA oxidase
    • Palmitoyl-CoA oxidase
    • Peroxisomal acyl coenzyme A oxidase 1
    • Peroxisomal acyl-coenzyme A oxidase 1
    • SCOX
    • Straight chain acyl CoA oxidase
    • Straight-chain acyl-CoA oxidase
    see all
  • FunctionCatalyzes the desaturation of very long chain acyl-CoAs to 2-trans-enoyl-CoAs.
  • PathwayLipid metabolism; peroxisomal fatty acid beta-oxidation.
  • Involvement in diseaseDefects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD) [MIM:264470]; also known as peroxisomal acyl-CoA oxidase deficiency. Pseudo-NALD is a peroxisomal single-enzyme disorder. Clinical features include mental retardation, leukodystrophy, seizures, mild hepatomegaly, hearing deficit. Pseudo-NALD is characterized by increased plasma levels of very-long chain fatty cids, due to decreased or absent peroxisome acyl-CoA oxidase activity. Peroxisomes are intact and functioning.
  • Sequence similaritiesBelongs to the acyl-CoA oxidase family.
  • Cellular localizationPeroxisome.
  • Target information above from: UniProt accession Q15067 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ACOX1 full length protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Human ACOX1 full length protein (ab114556)

ab114556 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"