Human ACTR1A full length protein (ab132058)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61163
    • SpeciesHuman
    • SequenceMESYDVSANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAG ALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQ TFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYAT GRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRK EGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIE IGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL DTFKKMWVSKKEYEEDGARSIHRKTF
    • Molecular weight67 kDa including tags
    • Amino acids1 to 376

Specifications

Our Abpromise guarantee covers the use of ab132058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • Actin related protein 1
    • Actin RPV
    • Actin-RPV
    • ACTR 1A
    • Actr1a
    • ACTZ_HUMAN
    • Alpha centractin
    • Alpha-centractin
    • ARP 1
    • ARP1
    • ARP1 actin related protein 1 homolog A
    • ARP1 actin related protein 1 homolog A centractin alpha
    • ARP1 yeast homolog A
    • Centractin
    • Centractin alpha
    • Centrosome associated actin homolog
    • Centrosome-associated actin homolog
    • CTRN 1
    • CTRN1
    • FLJ52695
    • FLJ52800
    • FLJ55002
    see all
  • FunctionComponent of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome.
  • Sequence similaritiesBelongs to the actin family. ARP1 subfamily.
  • Cellular localizationCytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Human ACTR1A full length protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab132058 at approximately 67.10 kDa.

References for Human ACTR1A full length protein (ab132058)

ab132058 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"