Overview

  • Product nameHuman ACY3 full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ96HD9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMCSLPVPREPLRRVAVTGGTHGNEMSG VYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSF LNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLI AKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGL ELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVG VVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGEST VYPVFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS
    • Molecular weight38 kDa including tags
    • Amino acids1 to 319
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab109954 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • 0610006H10Rik
    • AA3
    • ACY-3
    • acy3
    • ACY3_HUMAN
    • Acylase III
    • Aminoacylase 3
    • Aminoacylase III
    • Aminoacylase-3
    • ASPA2
    • Aspartoacylase (aminoacylase) 3
    • Aspartoacylase 2
    • Aspartoacylase-2
    • AW107362
    • EC 3.5.1.-
    • EC 3.5.1.15
    • HCBP1
    • Hepatitis C virus core binding protein 1
    • Hepatitis C virus core-binding protein 1
    • MGC108859
    • MGC9740
    • RGD1305394
    see all
  • FunctionPlays an important role in deacetylating mercapturic acids in kidney proximal tubules.
  • Sequence similaritiesBelongs to the AspA/AstE family. Aspartoacylase subfamily.
  • Cellular localizationApical cell membrane. Cytoplasm. Predominantly localized in the apical membrane of cells in the S1 segment. In the proximal straight tubules (S2 and S3 segments) is expressed diffusely throughout the cytoplasm.
  • Information by UniProt

Human ACY3 full length protein images

  • 15% SDS-PAGE analysis of ab109954 (3µg)

References for Human ACY3 full length protein (ab109954)

ab109954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"