Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP07311
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHT QAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHID KANFNNEKVILKLDYSDFQIVK
    • Molecular weight14 kDa including tags
    • Amino acids1 to 99
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab105127 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • Acylphosphatase
    • Acylphosphatase 1
    • Acylphosphatase 1 erythrocyte (common) type
    • Acylphosphatase 1 erythrocyte type
    • Acylphosphatase erythrocyte isozyme
    • Acylphosphatase organ common type isozyme
    • Acylphosphatase-1
    • Acylphosphatase1
    • Acylphosphate phosphohydrolase 1
    • ACYP 1
    • ACYP1
    • ACYP1_HUMAN
    • ACYPE
    • Erythrocyte acylphosphatase 1
    • erythrocyte isozyme
    • organ-common type isozyme
    see all
  • FunctionIts physiological role is not yet clear.
  • Tissue specificityOrgan-common type isozyme is found in many different tissues.
  • Sequence similaritiesBelongs to the acylphosphatase family.
    Contains 1 acylphosphatase-like domain.
  • Target information above from: UniProt accession P07311 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ACYP1 full length protein images

  • 15% SDS-PAGE showing ab105127 at approximately 13.6kDa (3µg).

References for Human ACYP1 full length protein (ab105127)

ab105127 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"