Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99965-2
    • SpeciesHuman
    • SequenceMWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIV IEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEG YPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADV SLYNEKDIESRDLSFKLQSVEYNHMGSDTTVVAQKVFQLIGLTNAIFVSF NITIILSSLELWIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLL VYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILAQLLSLSM GITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQ CLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATC RFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENH YVQTGHPCGLNQWICIDGVCMSGDKQCTDTFGKEVEFGPSECYSHLNSKT DVSGNCGISDSGYTQCEADNLQCGKLICKYVGKFLLQIPRATIIYANISG HLCIAVEFASDHADSQKMWIKDGTSCGSNKVCRNQRCVSSSYLGYDCTTD KCNDRGVCNNKKHCHCSASYLPPDCSVQSDLWPGGSIDSGNFPPVAIPAR LPERRYIENIYHSKPMRWPFFLFIPFFIIFCVLIAIMVKVNFQRKKWRTE DYSSDEQPESESEPKG
    • Molecular weight105 kDa including tags
    • Amino acids1 to 716

Specifications

Our Abpromise guarantee covers the use of ab117063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • A disintegrin and metalloproteinase domain 2
    • ADAM 2
    • ADAM metallopeptidase domain 2
    • Adam2
    • ADAM2_HUMAN
    • AI323749
    • Cancer/testis antigen 15
    • CRYN1
    • CRYN2
    • CT15
    • Disintegrin and metalloproteinase domain-containing protein 2
    • Fertilin beta
    • Fertilin subunit beta
    • Ftnb
    • PH 30
    • PH 30b
    • PH-30
    • PH30
    • Ph30 beta
    • PH30-beta
    see all
  • FunctionSperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein.
  • Tissue specificityExpressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
  • Sequence similaritiesContains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • DomainA tripeptide motif (FEE) within disintegrin-like domain could be involved in the binding to egg integrin receptor and thus could mediate sperm/egg binding.
  • Post-translational
    modifications
    The prodomain and the metalloprotease domain are cleaved during the epididymal maturation of the spermatozoa.
  • Cellular localizationMembrane.
  • Target information above from: UniProt accession Q99965 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ADAM2 full length protein images

  • 12.5% SDS-PAGE showing ab117063 at approximately 104.76 kDa.
    Stained with Coomassie Blue.

References for Human ADAM2 full length protein (ab117063)

ab117063 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"