Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP00326
    • SpeciesHuman
    • SequenceMSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSD EHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGK CRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQY TVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKP IQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI LPFEKINEGFDLLRSGKSIRTVLTF
    • Molecular weight67 kDa including tags
    • Amino acids1 to 375

Specifications

Our Abpromise guarantee covers the use of ab116935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ADH gamma subunit
    • ADH1C
    • ADH1G_HUMAN
    • Adh3
    • Alcohol dehydrogenase 1C
    • Alcohol dehydrogenase 1C (class I) gamma polypeptide
    • Alcohol dehydrogenase 1C gamma polypeptide
    • Alcohol dehydrogenase 3
    • Alcohol dehydrogenase 3 (class I) gamma polypeptide
    • Alcohol dehydrogenase subunit gamma
    • Aldehyde reductase
    • Class I alcohol dehydrogenase
    • OTTHUMP00000220209
    see all
  • Sequence similaritiesBelongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession P00326 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ADH1C full length protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116935 at approximately 67.32 kDa.

References for Human ADH1C full length protein (ab116935)

ab116935 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"