Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ8TD06
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQT YEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIM LNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRD LPLLIENMKKALRLIQSEL
    • Molecular weight20 kDa including tags
    • Amino acids22 to 166
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab108127 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • AG-3
    • AG3
    • Agr3
    • AGR3_HUMAN
    • Anterior gradient 3, xenopus, homolog of
    • Anterior gradient homolog 3
    • Anterior gradient homolog 3 (Xenopus laevis)
    • anterior gradient protein 3
    • Anterior gradient protein 3 homolog
    • BCMP11
    • Breast cancer membrane protein 11
    • Gm888
    • hAG 3
    • hAG-3
    • HAG3
    • OTTHUMP00000158512
    • PDIA18
    • Protein disulfide isomerase family A member 18
    see all
  • Sequence similaritiesBelongs to the AGR family.
  • Cellular localizationSecreted.
  • Target information above from: UniProt accession Q8TD06 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human AGR3 full length protein images

  • 15% SDS-PAGE analysis of 3µg ab108127.

References for Human AGR3 full length protein (ab108127)

ab108127 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"