Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP05062
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAHRFPALTQEQKKELSEIAQSIVAN GKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGG VILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYAS ICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEG TLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMS EEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQE AFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY
    • Molecular weight42 kDa including tags
    • Amino acids1 to 364
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab123165 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General info

  • Alternative names
    • ALDB
    • ALDO B
    • ALDO2
    • ALDOB
    • ALDOB_HUMAN
    • Aldolase 2
    • Aldolase B
    • Aldolase B fructose bisphosphate
    • Aldolase2
    • AldolaseB
    • EC 4.1.2.13
    • Fructose bisphosphate aldolase B
    • Fructose-bisphosphate aldolase B
    • Liver type aldolase
    • Liver-type aldolase
    • MS1077
    see all
  • PathwayCarbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in diseaseDefects in ALDOB are the cause of hereditary fructose intolerance (HFI) [MIM:229600]. HFI is an autosomal recessive disease that results in an inability to metabolize fructose and related sugars. Complete exclusion of fructose results in dramatic recovery; however, if not treated properly, HFI subjects suffer episodes of hypoglycemia, general ill condition, and risk of death the remainder of life.
  • Sequence similaritiesBelongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

Human ALDOB full length protein images

  • 15% SDS-PAGE showing ab123165 (3 µg) at approximately 42 kDa.

References for Human ALDOB full length protein (ab123165)

ab123165 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"