Human alpha 1 Fetoprotein-M3 fusion protein fragment (ab169839)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESS GGSNIEF GEFYFDLRLKGDK
    • Molecular weight
      25 kDa
    • Amino acids
      20 to 217

Specifications

Our Abpromise guarantee covers the use of ab169839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    As fusion protein fully derived from human protein, ab169839 can be used as coating matrix protein to replace human collagen type IV for human cell differentiation regulation study in vitro. ab169839 can be used in low serum or serum-free cell culture media to improve attachment and spreading of many normal and stem cells including human ES cell, endothelial, epithelial, hepatocytes and mesenchymal stem cells. ab169839 can be used to improve survival of primary cultures.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified. Sterile-filtered.
  • Form
    Liquid
  • Additional notes

    M3 Peptide GEFYFDLRLKGDK that is derived from human collagen type IV protein has been demonstrated in vitro as collagen mimetics and specific interacts with APP. This peptide will be a good coating matrix for cell attachment in serum free medium or enhance specific cell lineage differentiation. As fusion protein fully derived from human protein, ab169839 can be used as coating matrix protein to replace human collagen type IV for human cell differentiation regulation study in vitro. ab169839 can be used in low serum or serum-free cell culture media to improve attachment and spreading of many normal and stem cells including human ES cell, endothelial, epithelial, hepatocytes and mesenchymal stem cells. ab169839 can be used to improve survival of primary cultures.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituents: Potassium chloride, 0.32% Tris HCl, EDTA, Glycerol, Sodium chloride
    Note: Also contains DTT and Arginine.

General Info

  • Alternative names
    • Afp
    • AFPD
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • Function
    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificity
    Plasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similarities
    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stage
    Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications
    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab169839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up