Human alpha Glucosidase II protein fragment (ab91793)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVELTMAEGPYKIILT ARPFRL DLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQ PEETPRDGDKPEET QGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDF SLPGMEHVYGIPEHADNLRLKV TEGGEPYRLYNLDVFQYELYNPMALY GSVPVLLAHNPHRDLGIFWLNAAETWVDIS SNTAGKTLFGKMMDYLQG SGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASL TGTQALPPLF SLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRY FT WDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYV KTRD GSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLF VWNDMNEPSVFN GPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADG LRQRSGGMERPFVLARAFFA GSQRFGAVWTGDNTAEWDHLKISIPMCL SLGLVGLSFCGADVGGFFKNPEPELLVR WYQMGAYQPFFRAHAHLDTG RREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQA HREGIPVMRPLW VQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGE VWYD IQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPI TL FVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSS ADPEGHFETP IWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETS VLVLRKPGINVASDWSIH LR
    • Amino acids103 to 944

Specifications

Our Abpromise guarantee covers the use of ab91793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional NotesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 68 µl aqua dest.

General info

  • Alternative names
    • Alpha glucosidase II alpha subunit
    • Alpha-glucosidase 2
    • G2AN
    • GANAB
    • GANAB_HUMAN
    • Glu II
    • Glucosidase alpha neutral AB
    • Glucosidase II alpha
    • Glucosidase II subunit alpha
    • GluII
    • KIAA0088
    • Neutral alpha glucosidase AB
    • Neutral alpha glucosidase AB precursor
    • Neutral alpha-glucosidase AB
    see all
  • FunctionCleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
  • Tissue specificityDetected in placenta.
  • PathwayGlycan metabolism; N-glycan metabolism.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 31 family.
  • Cellular localizationEndoplasmic reticulum. Golgi apparatus. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Human alpha Glucosidase II protein fragment images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Human alpha Glucosidase II protein fragment (ab91793)

ab91793 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"