Human alpha smooth muscle Actin full length protein (ab134555)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP62736
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMEEEDSTALVCDNGSGLCKAGFAGDD APRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI ITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFE TFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI MRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEN EMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIH ETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
    • Molecular weight44 kDa including tags
    • Amino acids3 to 377
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % by SDS-PAGE.
    ab134555 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General info

  • Alternative names
    • AAT6
    • ACTA_HUMAN
    • ACTA2
    • Actin alpha 2 smooth muscle aorta
    • Actin aortic smooth muscle
    • Actin, aortic smooth muscle
    • ACTSA
    • ACTVS
    • Alpha 2 actin
    • Alpha actin 2
    • Alpha cardiac actin
    • Alpha-actin-2
    • Cell growth inhibiting gene 46 protein
    • Cell growth-inhibiting gene 46 protein
    • GIG46
    • Growth inhibiting gene 46
    • MYMY5
    see all
  • FunctionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Involvement in diseaseDefects in ACTA2 are the cause of aortic aneurysm familial thoracic type 6 (AAT6) [MIM:611788]. AATs are characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. They are primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance.
  • Sequence similaritiesBelongs to the actin family.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Human alpha smooth muscle Actin full length protein images

  • 15% SDS-PAGE analysis of 3 µg ab134555.

References for Human alpha smooth muscle Actin full length protein (ab134555)

ab134555 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab134555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"