Human ATF6 beta protein fragment (ab114637)

Overview

  • Product nameHuman ATF6 beta protein fragment
  • DescriptionHuman ATF6 beta protein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99941
    • SpeciesHuman
    • SequenceAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRC PEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
    • Molecular weight35 kDa including tags
    • Amino acids2 to 88

Specifications

Our Abpromise guarantee covers the use of ab114637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • Activating transcription factor 6 beta
    • Activating transcription factor 6 beta
    • ATF 6 beta
    • ATF6-beta
    • ATF6B
    • ATF6B_HUMAN
    • ATF6beta
    • cAMP response element binding protein related protein
    • cAMP response element-binding protein-related protein
    • cAMP responsive element binding protein like 1
    • cAMP-dependent transcription factor ATF-6 beta
    • cAMP-responsive element-binding protein-like 1
    • CREB L1
    • Creb related protein
    • CREB RP
    • Creb-rp
    • CREBL 1
    • CREBL1
    • Crebrp
    • Cyclic AMP dependent transcription factor ATF 6 beta
    • Cyclic AMP dependent transcription factor ATF6 beta
    • FLJ10066
    • G13
    • G13 protein
    • OTTHUMP00000029432
    • OTTHUMP00000029433
    • Processed cyclic AMP-dependent transcription factor ATF-6 beta
    • Protein G13
    see all
  • FunctionTranscriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN(9)CCAC[GA]-3') when NF-Y is bound to ERSE.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • DomainThe basic domain functions as a nuclear localization signal.
    The basic leucine-zipper domain is sufficient for association with the NF-Y trimer and binding to ERSE.
  • Post-translational
    modifications
    N-glycosylated.
    During unfolded protein response an approximative 60 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage is probably performed sequentially by site-1 and site-2 proteases.
  • Cellular localizationEndoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Target information above from: UniProt accession Q99941 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ATF6 beta protein fragment images

  • 12.5% SDS-PAGE image showing ab114637 Stained with Coomassie Blue.

References for Human ATF6 beta protein fragment (ab114637)

ab114637 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"