Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-BACH2 antibody (ab83364)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • Bach 2
    • Bach2
    • BACH2_HUMAN
    • Basic leucine zipper transcription factor 2
    • BTB and CNC homolog 2
    • BTB and CNC homology 1 basic leucine zipper transcription factor 2
    • BTB domain and CNC homolog 2
    • BTBD25
    • OTTHUMP00000016867
    • OTTHUMP00000016868
    • OTTHUMP00000040591
    • Transcription regulator protein BACH2
    see all
  • Function
    Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Play important roles in coordinating transcription activation and repression by MAFK.
  • Tissue specificity
    B-cell specific.
  • Sequence similarities
    Belongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References for Human BACH2 peptide (ab111653)

ab111653 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up