Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACK KHELYVSFRDLGWQDWIIAP EGYAAYYCEGECAFPLNSYMNATNHAIV QTLVHFINPETVPKPCCAPTQLNAISVLYFDDSS NVILKKYRNMVVRA CGCH
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab83921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • BMP 7
    • BMP-7
    • Bmp7
    • BMP7_HUMAN
    • Bone morphogenetic protein 7
    • Bone morphogenic protein 7
    • Eptotermin alfa
    • OP 1
    • OP-1
    • OP1
    • Osteogenic protein 1
    see all
  • FunctionInduces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Tissue specificityExpressed in the kidney and bladder. Lower levels seen in the brain.
  • Sequence similaritiesBelongs to the TGF-beta family.
  • Developmental stageExpressed in the developing eye, brain and ear during embryogenesis.
  • Post-translational
    modifications
    Several N-termini starting at positions 293, 300, 315 and 316 have been identified by direct sequencing resulting in secretion of different mature forms (PubMed:17977014).
  • Cellular localizationSecreted.
  • Information by UniProt

Human BMP7 full length protein images

  • Anti-BMP7 antibody (ab84684) at 1/1 dilution + Human BMP7 full length protein (ab83921) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 1 minute

References for Human BMP7 full length protein (ab83921)

ab83921 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"