Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-BMP7 antibody (ab56023)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • BMP 7
    • BMP-7
    • Bmp7
    • BMP7_HUMAN
    • Bone morphogenetic protein 7
    • Bone morphogenic protein 7
    • Eptotermin alfa
    • OP 1
    • OP-1
    • OP1
    • Osteogenic protein 1
    see all
  • Function
    Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Tissue specificity
    Expressed in the kidney and bladder. Lower levels seen in the brain.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Developmental stage
    Expressed in the developing eye, brain and ear during embryogenesis.
  • Post-translational
    modifications
    Several N-termini starting at positions 293, 300, 315 and 316 have been identified by direct sequencing resulting in secretion of different mature forms (PubMed:17977014).
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Human BMP7 peptide (ab111668)

ab111668 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up