Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-BMP7 antibody (ab56023)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • BMP 7
    • BMP-7
    • Bmp7
    • BMP7_HUMAN
    • Bone morphogenetic protein 7
    • Bone morphogenic protein 7
    • Eptotermin alfa
    • OP 1
    • OP-1
    • OP1
    • Osteogenic protein 1
    see all
  • Function
    Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Tissue specificity
    Expressed in the kidney and bladder. Lower levels seen in the brain.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Developmental stage
    Expressed in the developing eye, brain and ear during embryogenesis.
  • Post-translational
    modifications
    Several N-termini starting at positions 293, 300, 315 and 316 have been identified by direct sequencing resulting in secretion of different mature forms (PubMed:17977014).
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab111668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up