Human Calpain 3 protein fragment (ab114577)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20807
    • SpeciesHuman
    • SequenceNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYA DKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
    • Molecular weight37 kDa including tags
    • Amino acids722 to 821

Specifications

Our Abpromise guarantee covers the use of ab114577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • Calcium-activated neutral proteinase 3
    • calpain 3, (p94)
    • Calpain L3
    • Calpain large polypeptide L3
    • Calpain p94
    • calpain p94, large [catalytic] subunit
    • calpain, large polypeptide L3
    • Calpain-3
    • CAN3_HUMAN
    • CANP 3
    • CANP3
    • CANPL3
    • CAPN3
    • LGMD 2A
    • LGMD2
    • LGMD2A
    • Lp82
    • Lp85
    • MGC10767
    • MGC11121
    • MGC14344
    • MGC4403
    • Muscle-specific calcium-activated neutral protease 3
    • muscle-specific calcium-activated neutral protease 3 large subunit
    • nCL-1
    • New calpain 1
    • p94
    see all
  • FunctionCalcium-regulated non-lysosomal thiol-protease.
  • Tissue specificityIsoform I is skeletal muscle specific.
  • Involvement in diseaseDefects in CAPN3 are the cause of limb-girdle muscular dystrophy type 2A (LGMD2A) [MIM:253600]. LGMD2A is an autosomal recessive degenerative myopathy characterized by progressive symmetrical atrophy and weakness of the proximal limb muscles and elevated serum creatine kinase. The symptoms usually begin during the first two decades of life, and the disease gradually worsens, often resulting in loss of walking ability 10 or 20 years after onset.
  • Sequence similaritiesBelongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 4 EF-hand domains.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession P20807 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human Calpain 3 protein fragment images

  • ab114577 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Human Calpain 3 protein fragment (ab114577)

ab114577 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"