Human Cathelicidin full length protein (ab132945)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49913
    • SpeciesHuman
    • SequenceMKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRS SDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFK KDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEF KRIVQRIKDFLRNLVPRTES
    • Molecular weight46 kDa including tags
    • Amino acids1 to 170

Specifications

Our Abpromise guarantee covers the use of ab132945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • 18 kDa cationic antimicrobial protein
    • Antibacterial protein FALL-39
    • Antibacterial protein LL-37
    • CAMP
    • CAMP_HUMAN
    • CAP 18
    • CAP-18
    • CAP18
    • Cathelicidin antimicrobial peptide
    • Cathelin-like protein
    • Cathelin-related antimicrobial peptide
    • CATHL3
    • Cationic antimicrobial protein, 18-KD
    • CLP
    • Cnlp
    • Cramp
    • CRAMP, mouse, homolog of
    • FALL 39
    • FALL-39 peptide antibiotic
    • FALL39
    • hCAP 18
    • hCAP-18
    • hCAP18
    • HSD26
    • LL37
    • MCLP
    • Peptide antibiotic, PR-39, porcine, homolog of
    see all
  • FunctionBinds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
  • Tissue specificityExpressed in bone marrow and testis and neutrophils.
  • Sequence similaritiesBelongs to the cathelicidin family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationSecreted.
  • Target information above from: UniProt accession P49913 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human Cathelicidin full length protein images

  • 12.5% SDS-PAGE analysis of ab132945 stained with Coomassie Blue

References for Human Cathelicidin full length protein (ab132945)

ab132945 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"