Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: HGTELPSPPSKLQVSKVPSSLSQEQSEQDAIYQNLTQLK AAVGELSEK SKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAA VGELPEKSK LQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVG ELPEKSKLQ EIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGEL PDQSKQQQI YQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW HDSVTACQE VRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEG TWQWVDGSP LSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDN YWICKKPAA CFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTIS KAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLS LSPGK
    • Amino acids71 to 398

Specifications

Our Abpromise guarantee covers the use of ab83920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • C type lectin domain family 4, member M
    • C-type lectin domain family 4 member M
    • CD209 antigen like
    • CD209 antigen like protein 1
    • CD209 antigen-like protein 1
    • CD209L
    • CD209L1
    • CD299
    • CD299 antigen
    • CLC4M_HUMAN
    • CLEC4M
    • DC SIGN related protein
    • DC SIGN2
    • DC SIGNR
    • DC-SIGN-related protein
    • DC-SIGN2
    • DC-SIGNR
    • DCSIGN related protein
    • DCSIGNR
    • Dendritic cell-specific ICAM-3-grabbing non-integrin 2
    • HP10347
    • L SIGN
    • L-SIGN
    • Liver/lymph node specific ICAM3 grabbing nonintegrin
    • Liver/lymph node-specific ICAM-3-grabbing non-integrin
    • LSIGN
    • Mannose binding C type lectin DC SIGNR
    • MGC129964
    • MGC47866
    see all
  • FunctionProbable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a coreceptor for the SARS coronavirus.
  • Tissue specificityPredominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • DomainThe tandem repeat domain, also called neck domain, mediates oligomerization.
  • Cellular localizationSecreted and Cell membrane.
  • Target information above from: UniProt accession Q9H2X3 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human CD299 protein fragment images

  • Lane 1 – MW markers; Lane 2 – ab83920; Lane 3 – ab83920 treated with PNGase F to remove potential N-linked glycans. 10 µg protein loaded per lane. Deep Purple stained.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Band in lane 3 at 35 kDa is PNGase F protein.
  • A sample of ab83920 without carrier protein was reduced and alkylated. 40 µg protein was loaded, focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train (Deep Purple™ stained) indicates presence of multiple glycoforms of ab83920. Spots within the spot train were cut from the gel and identified by protein mass fingerprinting as CD299 (Fc Chimera).
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.
    The triangle indicates theoretical pI and MW.

References for Human CD299 protein fragment (ab83920)

ab83920 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"