Human Cytochrome P450 3A5 full length protein (ab114670)

Overview

  • Product nameHuman Cytochrome P450 3A5 full length protein
  • DescriptionHuman Cytochrome P450 3A5 full length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20815
    • SpeciesHuman
    • SequenceMDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNV LSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYS VFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIA QYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ DPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLS KSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAV VQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYA LHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMN MKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLS GE
    • Molecular weight81 kDa including tags
    • Amino acids1 to 502

Specifications

Our Abpromise guarantee covers the use of ab114670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • Aryl hydrocarbon hydroxylase
    • CP35
    • CP3A5_HUMAN
    • CYP3A5
    • CYPIIIA5
    • Cytochrome P450
    • Cytochrome P450 3A5
    • Cytochrome P450 family 3 subfamily A polypeptide 5
    • Cytochrome P450 HLp2
    • Cytochrome P450 subfamily IIIA (niphedipine oxidase) polypeptide 5
    • Cytochrome P450-PCN3
    • DKFZp686L16231
    • Flavoprotein linked monooxygenase
    • FLJ31317
    • HLp2
    • Microsomal monooxygenase
    • Niphedipine oxidase
    • P450PCN3
    • PCN3
    • Xenobiotic monooxygenase
    see all
  • FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Human Cytochrome P450 3A5 full length protein images

  • SDS-PAGE analysis of ab114670 on a 12.5% gel stained with Coomassie Blue.

References for Human Cytochrome P450 3A5 full length protein (ab114670)

ab114670 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"