Overview

  • Product nameHuman DARS full length protein
  • DescriptionHuman DARS full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP14868
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYG ISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVL RQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSC TQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEG GANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNK QFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLV KEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQ RIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF LGLHNVRQTSMFPRDPKRLTP
    • Molecular weight59 kDa including tags
    • Amino acids1 to 501
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % by SDS-PAGE.
    ab124568 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride

General info

  • Alternative names
    • Aspartate tRNA ligase
    • Aspartate tRNA ligase 1 cytoplasmic
    • Aspartate--tRNA ligase
    • Aspartyl tRNA synthetase
    • Aspartyl tRNA synthetase cytoplasmic
    • Aspartyl-tRNA synthetase
    • AspRS
    • Cell proliferation inducing gene 40 protein
    • Cell proliferation inducing protein 40
    • Cell proliferation-inducing gene 40 protein
    • cytoplasmic
    • Dars
    • DKFZp781B11202
    • MGC111579
    • SYDC_HUMAN
    see all
  • FunctionCatalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.
  • Sequence similaritiesBelongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession P14868 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human DARS full length protein images

  • 15% SDS-PAGE analysis of 3 µg ab124568.

References for Human DARS full length protein (ab124568)

ab124568 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"