Overview

  • Product nameHuman DCPS full length protein
  • DescriptionHuman DCPS full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ96C86
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMADAAPQLGKRKRELDVEEAHAASTEE KEAGVGNGTCAPVRLPFSGFR LQKVLRESARDKIIFLHGKVNEASGDG DGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQ LNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSI QWVYNILDKKAEADRIVFENPDPSD GFVLIPDLKWNQQQLDDLYLIAI CHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLP SY YHLHVHFTALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTF ALRADDPLLKLLQEAQQS
    • Molecular weight41 kDa including tags
    • Amino acids1 to 337
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab113138 was purified using conventional chromatography.
  • FormLiquid
  • Additional Notes


  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
    Mix suspension via gentle inversion before use.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General info

  • Alternative names
    • 1700001E16Rik
    • AA408441
    • DCPS
    • DCPS_HUMAN
    • DCS 1
    • DCS-1
    • DCS1
    • Decapping enzyme scavenger
    • heat shock-like protein 1
    • Hint 5
    • Hint related 7meGMP directed hydrolase
    • HINT-5
    • Hint-related 7meGMP-directed hydrolase
    • HINT5
    • Histidine triad protein member 5
    • homolog of C. elegans 7meGMP-directed hydrolase dcs-1
    • HSL1
    • HSPC015
    • m7GpppX diphosphatase
    • MGC124934
    • mRNA decapping enzyme
    • OTTMUSP00000042220
    • Scavenger mRNA decapping enzyme DcpS
    • Scavenger mRNA-decapping enzyme DcpS
    see all
  • FunctionNecessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides.
  • Tissue specificityDetected in liver, brain, kidney, testis and prostate.
  • Sequence similaritiesBelongs to the HIT family.
  • Cellular localizationCytoplasm. Nucleus.
  • Target information above from: UniProt accession Q96C86 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human DCPS full length protein images

  • 15% SDS-PAGE analysis of (3µg)

References for Human DCPS full length protein (ab113138)

ab113138 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"