Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12882
    • SpeciesHuman
    • SequenceMAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCF NCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSF ITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL
    • Molecular weight45 kDa including tags
    • Amino acids1 to 173

Specifications

Our Abpromise guarantee covers the use of ab114584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • DHP
    • DHPDHase
    • Dihydropyrimidine dehydrogenase
    • Dihydropyrimidine dehydrogenase [NADP(+)]
    • Dihydropyrimidine dehydrogenase [NADP+]
    • Dihydrothymine dehydrogenase
    • Dihydrouracil dehydrogenase
    • DPD
    • DPYD
    • DPYD_HUMAN
    • MGC132008
    • MGC70799
    • OTTHUMP00000058954
    see all
  • FunctionInvolved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine. Also involved the degradation of the chemotherapeutic drug 5-fluorouracil.
  • Tissue specificityFound in most tissues with greatest activity found in liver and peripheral blood mononuclear cells.
  • PathwayAmino-acid biosynthesis; beta-alanine biosynthesis.
  • Involvement in diseaseDefects in DPYD are the cause of dihydropyrimidine dehydrogenase deficiency (DPYD deficiency) [MIM:274270]; also known as hereditary thymine-uraciluria or familial pyrimidinemia. DPYD deficiency is a disease characterized by persistent urinary excretion of excessive amounts of uracil, thymine and 5-hydroxymethyluracil. Patients suffering from this disease show a severe reaction to the anticancer drug 5-fluorouracil. This reaction includes stomatitis, Leukopenia, thrombocytopenia, hair loss, diarrhea, fever, marked weight loss, cerebellar ataxia, and neurologic symptoms, progressing to semicoma.
  • Sequence similaritiesBelongs to the dihydropyrimidine dehydrogenase family.
    Contains 3 4Fe-4S ferredoxin-type domains.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession Q12882 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human DPYD full length protein images

  • 12.5% SDS-PAGE showing ab114584 at approximately 45.03kDa stained with Coomassie Blue.

References for Human DPYD full length protein (ab114584)

ab114584 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"