Recombinant Human Dysbindin protein (ab87462)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Dysbindin protein -
Purity
> 95 % SDS-PAGE.
Purified using conventional chromatography. -
Expression system
Escherichia coli -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMLSAHWEKKKTSLV ELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELE RCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKER QKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMD ISDQEALDVFLNSGGEENTVLSPALGPESSTCQNEITLQVPNPSELRAKP PSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDG GEDSDS -
Amino acids
1 to 270
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab87462 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.0077% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- DTBP1_HUMAN
- DTNBP1
- Dysbindin
see all -
Function
The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking. Plays a role in synaptic vesicle trafficking and in neurotransmitter release. May be required for normal dopamine homeostasis in the cerebral cortex, hippocampus, and hypothalamus. Plays a role in the regulation of cell surface exposure of DRD2. Contributes to the regulation of dopamine signaling. May play a role in actin cytoskeleton reorganization and neurite outgrowth. May modulate MAPK8 phosphorylation. -
Tissue specificity
Detected in brain, in neurons and in neuropil. Detected in dentate gyrus and in pyramidal cells of hippocampus CA2 and CA3 (at protein level). -
Involvement in disease
Defects in DTNBP1 are the cause of Hermansky-Pudlak syndrome type 7 (HPS7) [MIM:203300]. Hermansky-Pudlak syndrome (HPS) is a genetically heterogeneous, rare, autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS. -
Sequence similarities
Belongs to the dysbindin family. -
Post-translational
modificationsUbiquitinated by TRIM32. Ubiquitination leads to DTNBP1 degradation.
Phosphorylated by PRKDC. -
Cellular localization
Cytoplasm. Cytoplasmic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Endosome membrane. Melanosome membrane. Nucleus. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Endoplasmic reticulum. Detected in neuron cell bodies, axons and dendrites. Detected at synapses, at post-synaptic density, at pre-synaptic vesicle membranes and microtubules. Detected at tubulovesicular elements in the vicinity of the Golgi apparatus and of melanosomes. Occasionally detected at the membrane of pigmented melanosomes in cultured melanoma cells. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab87462 has not yet been referenced specifically in any publications.