Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96ID7
    • SpeciesHuman
    • SequenceMESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANF VFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
    • Molecular weight35 kDa including tags
    • Amino acids1 to 83

Specifications

Our Abpromise guarantee covers the use of ab114610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • dE2F2
    • E2F transcription factor 2
    • E2F-2
    • E2F2
    • E2F2_HUMAN
    • Transcription factor E2F2
    see all
  • FunctionTranscription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner.
  • Tissue specificityHighest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
  • Sequence similaritiesBelongs to the E2F/DP family.
  • Post-translational
    modifications
    Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.
  • Cellular localizationNucleus.
  • Target information above from: UniProt accession Q14209 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human E2F2 full length protein images

  • ab114610 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Human E2F2 full length protein (ab114610)

ab114610 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"