Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP41567
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMSAIQNLHSFDPF ADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAF KKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
    • Molecular weight17 kDa including tags
    • Amino acids1 to 113
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % by SDS-PAGE.
    ab117156 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional NotesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 10% Glycerol

General info

  • Alternative names
    • A121
    • eIF1
    • EIF1_HUMAN
    • EIF1A
    • Eukaryotic translation initiation factor 1
    • ISO1
    • Protein translation factor SUI1 homolog
    • SUI1
    • Sui1iso1
    see all
  • FunctionNecessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
  • Sequence similaritiesBelongs to the SUI1 family.
  • Target information above from: UniProt accession P41567 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Human eIF1 full length protein (ab117156)

ab117156 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"