Human Endothelin 3 full length protein (ab158334)

Overview

  • Product nameHuman Endothelin 3 full length protein
  • DescriptionHuman Endothelin 3 full length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETV AGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCF TYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQ LSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVK DQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
    • Amino acids1 to 238
    • Tagsproprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • EDN3
    • EDN3_HUMAN
    • Endothelin-3
    • ET 3
    • ET-3
    • ET3
    • MGC15067
    • MGC61498
    • PPET3
    • Preproendothelin 3
    • Preproendothelin-3
    see all
  • FunctionEndothelins are endothelium-derived vasoconstrictor peptides.
  • Tissue specificityExpressed in trophoblasts and placental stem villi vessels, but not in cultured placental smooth muscle cells.
  • Involvement in diseaseDefects in EDN3 are the cause of Hirschsprung disease type 4 (HSCR4) [MIM:613712]; also known as aganglionic megacolon (MGC). A genetic disorder of neural crest development characterized by the absence of intramural ganglion cells in the hindgut; often resulting in intestinal obstruction.
    Defects in EDN3 are a cause of congenital central hypoventilation syndrome (CCHS) [MIM:209880]; also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.
    Defects in EDN3 are a cause of Waardenburg syndrome type 4 (WS4B) [MIM:613265]; also known as Waardenburg-Shah syndrome. WS4B is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
  • Sequence similaritiesBelongs to the endothelin/sarafotoxin family.
  • Cellular localizationSecreted.
  • Information by UniProt

Human Endothelin 3 full length protein images

  • ab158334 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Human Endothelin 3 full length protein (ab158334)

ab158334 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab158334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"