Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP13929
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAMQKIFAREILDSRGNPTVEVDLHTAKGR FRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINSTLGPALLQK KLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPL YRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKE AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTA IQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQ AVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTF IADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAIFAGRKFRN PKAK
    • Molecular weight49 kDa including tags
    • Amino acids1 to 434
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab113127 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride

General info

  • Alternative names
    • 2 phospho D glycerate hydrol yase
    • 2 phospho D glycerate hydrolyase
    • 2-phospho-D-glycerate hydro-lyase
    • Beta enolase
    • Beta-enolase
    • ENO3
    • ENOB_HUMAN
    • Enolase 3
    • Enolase 3 (beta muscle)
    • Enolase3
    • GSD13
    • MSE
    • Muscle specific enolase
    • Muscle-specific enolase
    • Skeletal muscle enolase
    see all
  • FunctionAppears to have a function in striated muscle development and regeneration.
  • Tissue specificityThe alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • PathwayCarbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Involvement in diseaseDefects in ENO3 are the cause of glycogen storage disease type 13 (GSD13) [MIM:612932]. A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen-beta particles are detected on ultrastructural analysis.
  • Sequence similaritiesBelongs to the enolase family.
  • Developmental stageDuring ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localizationCytoplasm. Localized to the Z line. Some colocalization with CKM at M-band.
  • Information by UniProt

Human ENO3 full length protein images

  • 15% SDS-PAGE analysis of ENO3 protein (ab113127; 3 µg).

References for Human ENO3 full length protein (ab113127)

ab113127 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"