Human ENTPD3 full length protein (ab116928)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75355
    • SpeciesHuman
    • SequenceMFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEV LPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGIS SYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNE TAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEK NLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGY VYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTM GHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQ ETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCS QNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEK EE
    • Molecular weight76 kDa including tags
    • Amino acids1 to 452

Specifications

Our Abpromise guarantee covers the use of ab116928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ATPDase
    • CD39 antigen like 3
    • CD39 antigen-like 3
    • CD39 like 3
    • CD39L3
    • Ecto apyrase
    • Ecto ATP diphosphohydrolase
    • Ecto-apyrase 3
    • Ecto-ATP diphosphohydrolase 3
    • Ecto-ATPase 3
    • Ecto-ATPDase 3
    • Ectonucleoside triphosphate diphosphohydrolase 3
    • ENTP3_HUMAN
    • ENTPD 3
    • ENTPD3
    • FLJ93839
    • HB 6
    • HB6
    • NTPDase 3
    • NTPDase3
    • OTTHUMP00000162079
    • OTTHUMP00000209227
    • OTTHUMP00000209228
    see all
  • FunctionHas a threefold preference for the hydrolysis of ATP over ADP.
  • Tissue specificityExpressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the GDA1/CD39 NTPase family.
  • Cellular localizationMembrane.
  • Information by UniProt

Human ENTPD3 full length protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116928 at approximately 75.79 kDa.

References for Human ENTPD3 full length protein (ab116928)

ab116928 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"