Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKE
    • Amino acids
      37 to 86

Specifications

Our Abpromise guarantee covers the use of ab86152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • Alpha chain
    • Fc fragment of IgG, receptor transporter, alpha
    • FCGRN_HUMAN
    • FCGRT
    • FcRn
    • FcRn alpha chain
    • FCRN, alpha chain
    • IgG Fc fragment receptor transporter alpha chain
    • IgG Gc receptor
    • IgG receptor FcRn large subunit p51
    • IgG receptor FcRn large subunit p51 precursor
    • Immunoglobulin receptor, intestinal, heavy chain
    • Neonatal Fc receptor
    see all
  • Function
    Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References for Human FCGRT peptide (ab86152)

ab86152 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up