Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA ERGGHWYKEGSRLAPAGRVR GWRGRLEIASFLPEDAGRYLCLARGSMI VLQNLTLITGDSLTSSNDDEDPKSHRDLSNRHS YPQQAPYWTHPQRME KKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIR IPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCRVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids22 to 201

Specifications

Our Abpromise guarantee covers the use of ab83999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD 334
    • CD334
    • CD334 antigen
    • fc13h 10
    • fc13h10
    • Fgfr 4
    • FGFR-4
    • Fgfr4
    • FGFR4_HUMAN
    • Fibroblast growth factor receptor 4
    • Hydroxyaryl protein kinase
    • JTK 2
    • JTK2
    • MGC20292
    • Protein tyrosine kinase
    • TKF
    • Tyrosine kinase related to fibroblast growth factor receptor
    • Tyrosylprotein kinase
    see all
  • FunctionReceptor for acidic fibroblast growth factor. Does not bind to basic fibroblast growth factor. Binds FGF19.
  • Tissue specificityExpressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated on tyrosine residue (By similarity). Phosphorylation requires the presence of a functional (phosphorylated) FGFR1 and not necessarily by means of FGFR heterodimerization.
  • Cellular localizationMembrane. Isoform 2 may be secreted.
  • Target information above from: UniProt accession P22455 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human FGFR4 protein fragment images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Human FGFR4 protein fragment (ab83999)

ab83999 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"