Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-GCLM antibody (ab81445)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • Gamma ECS regulatory subunit
    • Gamma-ECS regulatory subunit
    • Gamma-glutamylcysteine synthetase regulatory subunit
    • GCLM
    • GCS light chain
    • GLCLR
    • Glutamate cysteine ligase regulatory subunit
    • Glutamate--cysteine ligase modifier subunit
    • Glutamate--cysteine ligase regulatory subunit
    • GSC light chain
    • GSH0_HUMAN
    see all
  • Tissue specificity
    In all tissues examined. Highest levels in skeletal muscle.
  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 1/2.
  • Sequence similarities
    Belongs to the aldo/keto reductase family. Glutamate--cysteine ligase light chain subfamily.
  • Information by UniProt

References for Human GCLM peptide (ab111661)

ab111661 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up