Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-GCLM antibody (ab81445)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • Gamma ECS regulatory subunit
    • Gamma-ECS regulatory subunit
    • Gamma-glutamylcysteine synthetase regulatory subunit
    • GCLM
    • GCS light chain
    • GLCLR
    • Glutamate cysteine ligase regulatory subunit
    • Glutamate--cysteine ligase modifier subunit
    • Glutamate--cysteine ligase regulatory subunit
    • GSC light chain
    • GSH0_HUMAN
    see all
  • Tissue specificity
    In all tissues examined. Highest levels in skeletal muscle.
  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 1/2.
  • Sequence similarities
    Belongs to the aldo/keto reductase family. Glutamate--cysteine ligase light chain subfamily.
  • Information by UniProt

References

ab111661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up