Human GDF15 full length protein (ab50077)

Overview

Description

  • NatureNatural
  • SourceCell Culture
  • Amino Acid Sequence
    • AccessionQ99988
    • SpeciesHuman
    • SequenceARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPS QFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQT YDDLLAKDCHCI
    • Amino acids197 to 308
    • Additional sequence informationThe processed mature form of this protein is from aa 195 to 308.

Specifications

Our Abpromise guarantee covers the use of ab50077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • Purity> 98 % by SDS-PAGE.
    ab50077 purity was determined also by HPLC Endotoxin level is less than 0.1 ng per µg (1EU/µg).
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C.

  • ReconstitutionReconstitute to 1mg/ml with distilled water.

General info

  • Alternative names
    • GDF 15
    • GDF-15
    • Gdf15
    • GDF15_HUMAN
    • Growth differentiation factor 15
    • Growth/differentiation factor 15
    • Macrophage inhibitory cytokine 1
    • MIC 1
    • Mic-1
    • MIC1
    • NAG 1
    • NAG-1
    • NAG1
    • NRG 1
    • NRG-1
    • NRG1
    • NSAID
    • NSAID (nonsteroidal anti inflammatory drug) activated protein 1
    • NSAID regulated protein 1
    • NSAID-activated gene 1 protein
    • NSAID-regulated gene 1 protein
    • PDF
    • PLAB
    • Placental bone morphogenetic protein
    • Placental bone morphogenic protein
    • Placental TGF beta
    • Placental TGF-beta
    • Prostate differentiation factor
    • PTGF beta
    • PTGFB
    see all
  • Tissue specificityHighly expressed in placenta, with lower levels in prostate and colon and some expression in kidney.
  • Sequence similaritiesBelongs to the TGF-beta family.
  • Cellular localizationSecreted.
  • Target information above from: UniProt accession Q99988 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Human GDF15 full length protein (ab50077)

ab50077 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

I have recieved from the lab further information about ab50077 GDF15 protein. This product was was lyophilized from 10 mM Sodium Citrate, pH 3.0.

I hope this information is helpful to you. Please d...

Read More

Thank you very much for contacting us with your question.

I can confirm that the GDF15 protein ab50077 is naturally secreted by a proprietary cell line and then purified. No recombinant techniques are involved in the production of this protei...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"