Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Gli1 antibody (ab49314)

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

  • Reconstitution
    Add 100ul of distilled water. Final peptide concentration is 1 mg/ml in water.

General Info

  • Alternative names
    • GLI
    • Gli 1
    • GLI family zinc finger 1
    • GLI Kruppel family member 1
    • gli1
    • GLI1_HUMAN
    • Glioma associated oncogene 1
    • Glioma associated oncogene homolog
    • Glioma associated oncogene homolog 1 (zinc finger protein)
    • Glioma-associated oncogene
    • Oncogene GLI
    • Zfp 5
    • Zfp5
    • Zinc finger protein GLI 1
    • Zinc finger protein GLI1
    see all
  • Function
    Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.
  • Tissue specificity
    Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract.
  • Sequence similarities
    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated in vitro by ULK3.
  • Cellular localization
    Cytoplasm. Nucleus. Tethered in the cytoplasm by binding to SUFU. Activation and translocation to the nucleus is promoted by interaction with STK36. Phosphorylation by ULK3 may promote nuclear localization. Translocation to the nucleus is promoted by interaction with ZIC1.
  • Information by UniProt

References for Human Gli1 peptide (ab111659)

ab111659 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up