Recombinant Human Glutamate Receptor 1 (AMPA subtype) protein (ab112297)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human Glutamate Receptor 1 (AMPA subtype) protein
See all Glutamate Receptor 1 (AMPA subtype) proteins and peptides -
Biological activity
useful for Antibody Production and Protein Array -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANV TGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM -
Predicted molecular weight
37 kDa including tags -
Amino acids
201 to 300 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab112297 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
useful for Antibody Production and Protein Array -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
Glutathione is reduced
General Info
-
Alternative names
- GLUR 1
- GLUR A
- AMPA 1
see all -
Function
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. -
Tissue specificity
Widely expressed in brain. -
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily. -
Post-translational
modificationsPalmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Cell junction > synapse > postsynaptic cell membrane. Interaction with CACNG2 promotes cell surface expression. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab112297 has been referenced in 1 publication.
- Zhu W et al. Structural Investigation of the Interaction Mechanism between Chlorogenic Acid and AMPA Receptor via In Silico Approaches. Molecules 27:N/A (2022). PubMed: 35684330