Human Glutamate Receptor 1 (AMPA subtype) protein fragment (ab112297)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP42261
    • SpeciesHuman
    • SequenceVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANV TGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
    • Molecular weight37 kDa including tags
    • Amino acids201 to 300

Specifications

Our Abpromise guarantee covers the use of ab112297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional Notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General info

  • Alternative names
    • GLUR 1
    • GLUR A
    • AMPA 1
    • AMPA selective glutamate receptor 1
    • AMPA-selective glutamate receptor 1
    • GluA1
    • GLUH1
    • GluR K1
    • GluR-1
    • GluR-A
    • GluR-K1
    • GLUR1
    • GLURA
    • GluRK1
    • Glutamate receptor 1
    • Glutamate receptor ionotropic
    • Glutamate receptor ionotropic AMPA 1
    • Glutamate receptor, ionotropic, AMPA 1
    • Gria1
    • GRIA1_HUMAN
    • HBGR1
    • MGC133252
    • OTTHUMP00000160643
    • OTTHUMP00000165781
    • OTTHUMP00000224241
    • OTTHUMP00000224242
    • OTTHUMP00000224243
    see all
  • FunctionIonotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Tissue specificityWidely expressed in brain.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.
  • Post-translational
    modifications
    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localizationCell membrane. Endoplasmic reticulum membrane. Cell junction > synapse > postsynaptic cell membrane. Interaction with CACNG2 promotes cell surface expression.
  • Information by UniProt

Human Glutamate Receptor 1 (AMPA subtype) protein fragment images

  • ab112297 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Human Glutamate Receptor 1 (AMPA subtype) protein fragment (ab112297)

ab112297 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"