Human Glutathione S Transferase theta 2 protein fragment (ab116911)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP0CG30
    • SpeciesHuman
    • SequenceWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWR GRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
    • Molecular weight37 kDa including tags
    • Amino acids145 to 244

Specifications

Our Abpromise guarantee covers the use of ab116911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • AI266894
    • EC 2.5.1.18
    • Glutathione S transferase 12
    • Glutathione S transferase Yrs Yrs
    • Glutathione S-transferase theta-2
    • Glutathione S-transferase theta-2B
    • GST 12 12
    • GST class theta 2
    • GST class-theta-2
    • GST T2
    • GSTT 2
    • GSTT2
    • GSTT2 protein
    • GSTT2_HUMAN
    • GSTT2B
    • GSTT2P
    • MGC182032
    • mGSTT2
    • OTTHUMP00000198491
    • OTTHUMP00000198492
    • Yrs
    see all
  • FunctionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
  • Tissue specificityExpressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
  • Sequence similaritiesBelongs to the GST superfamily. Theta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Human Glutathione S Transferase theta 2 protein fragment images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116911 at approximately 36.63 kDa.

References for Human Glutathione S Transferase theta 2 protein fragment (ab116911)

ab116911 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"