Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Glypican 3 antibody (ab66596)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • DGSX
    • Glypican proteoglycan 3
    • Glypican-3 [Precursor]
    • Gpc3
    • GPC3_HUMAN
    • GTR2 2
    • GTR2-2
    • Heparan sulphate proteoglycan
    • Intestinal protein OCI 5
    • Intestinal protein OCI-5
    • MXR7
    • OCI 5
    • OCI-5
    • OCI5
    • SDYS
    • Secreted glypican-3
    • SGB
    • SGBS
    • SGBS1
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition.
  • Tissue specificity
    Highly expressed in lung, liver and kidney.
  • Involvement in disease
    Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1) [MIM:312870]; also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies.
  • Sequence similarities
    Belongs to the glypican family.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab111665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up