Overview

  • Product nameHuman HDHD2 full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ9H0R4
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQE ALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAAR SLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQA FRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRA SDEEKINPPPYLTCESFPHAVDHILQHLL
    • Molecular weight31 kDa including tags
    • Amino acids1 to 259
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab101940 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • 0610039H12Rik
    • 3110052N05Rik
    • DKFZP564D1378
    • Haloacid dehalogenase like hydrolase domain containing 2
    • Haloacid dehalogenase-like hydrolase domain-containing protein 2
    • HDHD2
    • HDHD2_HUMAN
    • Ier3ip1
    • Immediate early response 3 interacting protein 1
    • LRRG00122
    • OTTMUSP00000045339
    • OTTMUSP00000045340
    • OTTMUSP00000045341
    • OTTMUSP00000045343
    • OTTMUSP00000045344
    • RGD1308579
    see all
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

Human HDHD2 full length protein images

  • 15% SDS-PAGE analysis of 3µg ab101940.

References for Human HDHD2 full length protein (ab101940)

ab101940 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"