Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Specifications

Our Abpromise guarantee covers the use of ab111673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • D2HGA2
    • ICD-M
    • IDH
    • IDH2
    • IDHM
    • IDHP_HUMAN
    • IDP
    • IDPM
    • Isocitrate dehydrogenase [NADP], mitochondrial
    • Isocitrate dehydrogenase 2 (NADP+), mitochondrial
    • mNADP-IDH
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    see all
  • Function
    Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
  • Involvement in disease
    D-2-hydroxyglutaric aciduria 2
    Glioma
    enetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma.
  • Sequence similarities
    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications
    Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

References for Human IDH2 peptide (ab111673)

ab111673 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up