Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Specifications

Our Abpromise guarantee covers the use of ab111673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • D2HGA2
    • ICD-M
    • IDH
    • IDH2
    • IDHM
    • IDHP_HUMAN
    • IDP
    • IDPM
    • Isocitrate dehydrogenase [NADP], mitochondrial
    • Isocitrate dehydrogenase 2 (NADP+), mitochondrial
    • mNADP-IDH
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    see all
  • Function
    Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
  • Involvement in disease
    D-2-hydroxyglutaric aciduria 2
    Glioma
    enetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma.
  • Sequence similarities
    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications
    Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

References

ab111673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up