Human IL1 Receptor I protein fragment (ab83575)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTIT WYKDDSKTP VSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYC LRIKISAKF VENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNEN NELPKLQWY KDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY TYLGKQYPI TRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLIC NVTGQLSDI AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVL NISEIESRF YKHPFTCFAKNTHGIDAAYIQLIYPVTNRSSNTKVDKKV EPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYK CRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids18 to 333

Specifications

Our Abpromise guarantee covers the use of ab83575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • Antigen CD121a
    • CD121 antigen-like family member A
    • CD121A
    • CD121a antigen
    • D2S1473
    • IL 1
    • IL 1R 1
    • IL 1R alpha
    • IL 1RT1
    • IL-1R-1
    • IL-1R-alpha
    • IL-1RT-1
    • IL-1RT1
    • IL1 inhibitor
    • IL1R
    • IL1R1
    • IL1R1_HUMAN
    • IL1RA
    • IL1RN
    • IL1RT1
    • Interleukin 1 receptor alpha type 1
    • Interleukin 1 receptor antagonist protein (IRAP)
    • Interleukin 1 receptor type I
    • Interleukin receptor 1
    • Interleukin-1 receptor alpha
    • Interleukin-1 receptor type 1
    • Interleukin-1 receptor type I
    • P80
    see all
  • FunctionReceptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2.
  • Sequence similaritiesBelongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Human IL1 Receptor I protein fragment images

  • Densitometry of protein isoforms visualised by 2-DE. Spot trains are normal in human proteins and highlight the presence of multiple isoforms which differ according to their level of post-translational modification. The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83575 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1 – MW markers; Lane 2 – ab83575; Lane 3 – ab83575 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83575 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.

References for Human IL1 Receptor I protein fragment (ab83575)

ab83575 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"