Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQM KDQLDNLLLKESLLEDFKGYLG CQALSEMIQFYLEEVMPQAENQDPDI KAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE QVKNAFNKLQEKG IYKAMSEFDIFINYIEAYMTMKIRN
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab84147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CSIF
    • Cytokine synthesis inhibitory factor
    • GVHDS
    • IL 10
    • IL-10
    • IL10
    • IL10_HUMAN
    • IL10A
    • Interleukin 10
    • Interleukin-10
    • MGC126450
    • MGC126451
    • T-cell growth inhibitory factor
    • TGIF
    see all
  • FunctionInhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificityProduced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similaritiesBelongs to the IL-10 family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Human IL10 full length protein (ab84147)

ab84147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"