Human IL2 Receptor gamma protein fragment (ab84065)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQ CFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSE EITSGCQLQ KKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAP ENLTLHKLS ESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYR HKFSLPSVD GQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKE NPFLFAWIP KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids23 to 259

Specifications

Our Abpromise guarantee covers the use of ab84065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD132
    • common cytokine receptor gamma chain
    • Cytokine receptor common subunit gamma
    • Gamma C
    • gamma(c)
    • gammaC
    • IL-2 receptor subunit gamma
    • IL-2R gamma chain
    • IL-2R subunit gamma
    • IL-2RG
    • IL2RG
    • IL2RG_HUMAN
    • IMD4
    • interleukin 2 receptor, gamma
    • Interleukin-2 receptor subunit gamma
    • P64
    • SCIDX
    • SCIDX1
    see all
  • FunctionCommon subunit for the receptors for a variety of interleukins.
  • Involvement in diseaseDefects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID) [MIM:300400]; also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) [MIM:312863]. XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.
  • Information by UniProt

Human IL2 Receptor gamma protein fragment images

  • 1D SDS-PAGE of ab84065 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab84065
    Lane 2: ab84065 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab84065 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10 µg protein loaded per lane; Deep Purple™ stained.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent drop in MW after treatment with glycosidase cocktail indicates presence of O-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes.
  • A sample of ab84065 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel.
    40 µg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms. Spots within the spot train were cut from the gel and identified as IL2 Receptor gamma (Fc Chimera) by protein mass fingerprinting.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Human IL2 Receptor gamma protein fragment (ab84065)

ab84065 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"