Human IL7R alpha protein fragment (ab83827)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAF EDPDVNITNLEFEICGALVEVKCL NFRKLQEIYFIETKKFLLIGKSNI CVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVT FNTSHL QKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKV RSIPDHY FKGFWSEWSPSYYFRTPEINNSSGGIPKVDKKVEPKSCDKT HTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEY KCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
    • Amino acids21 to 236

Specifications

Our Abpromise guarantee covers the use of ab83827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD 127
    • CD127
    • CD127 antigen
    • CDW127
    • IL 7R
    • IL 7R alpha
    • IL-7 receptor subunit alpha
    • IL-7R subunit alpha
    • IL-7R-alpha
    • IL-7RA
    • IL7R
    • IL7RA
    • IL7RA_HUMAN
    • IL7Ralpha
    • ILRA
    • Interleukin 7 receptor
    • Interleukin 7 receptor alpha chain
    • Interleukin 7 receptor isoform H5 6
    • Interleukin-7 receptor subunit alpha
    see all
  • FunctionReceptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
  • Involvement in diseaseDefects in IL7R are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Genetic variations in IL7R are a cause of susceptibility to multiple sclerosis type 3 (MS3) [MIM:612595]. A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. Note=A polymorphism at position 244 strongly influences susceptibility to multiple sclerosis. Overtransmission of the major 'C' allele coding for Thr-244 is detected in offspring affected with multiple sclerosis. In vitro analysis of transcripts from minigenes containing either 'C' allele (Thr-244) or 'T' allele (Ile-244) shows that the 'C' allele results in an approximately two-fold increase in the skipping of exon 6, leading to increased production of a soluble form of IL7R. Thus, the multiple sclerosis associated 'C' risk allele of IL7R would probably decrease membrane-bound expression of IL7R. As this risk allele is common in the general population, some additional triggers are probably required for the development and progression of MS.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    N-glycosylated IL-7Ralpha binds IL7 300-fold more tightly than the unglycosylated form.
  • Cellular localizationSecreted and Cell membrane.
  • Target information above from: UniProt accession P16871 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human IL7R alpha protein fragment images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83827 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83827
    Lane 2: ab83827 treated with PNGase F to remove potential N-linked glycans
    10 µg protein loaded per lane; Deep Purple™ stained.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans.

References for Human IL7R alpha protein fragment (ab83827)

ab83827 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"