Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS

Specifications

Our Abpromise guarantee covers the use of ab111654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • Cytosolic inhibitor of Nrf2
    • INrf 2
    • INrf2
    • Keap 1
    • KEAP1
    • KEAP1_HUMAN
    • Kelch like ECH associated protein 1
    • Kelch like family member 19
    • Kelch like protein 19
    • Kelch-like ECH-associated protein 1
    • Kelch-like protein 19
    • KIAA0132
    • KLHL 19
    • KLHL19
    • MGC10630
    • MGC1114
    • MGC20887
    • MGC4407
    • MGC9454
    see all
  • Function
    Retains NFE2L2/NRF2 in the cytosol. Functions as substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1. Targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. May also retain BPTF in the cytosol. Targets PGAM5 for ubiquitination and degradation by the proteasome.
  • Tissue specificity
    Broadly expressed, with highest levels in skeletal muscle.
  • Sequence similarities
    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Domain
    The Kelch repeats mediate interaction with NF2L2/NRF2, BPTF and PGAM5.
  • Post-translational
    modifications
    Ubiquitinated and subject to proteasomal degradation.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between cytoplasm and nucleus.
  • Information by UniProt

References for Human Keap1 peptide (ab111654)

ab111654 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up