Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
    • Amino acids
      648 to 697

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-KHSRP antibody (ab83291)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • Far upstream element-binding protein 2
    • FBP2
    • FUBP2
    • FUBP2_HUMAN
    • FUSE binding protein 2
    • FUSE-binding protein 2
    • KH type splicing regulatory protein
    • KH type splicing regulatory protein (FUSE binding protein 2)
    • KH type-splicing regulatory protein
    • KHSRP
    • KSRP
    • p75
    see all
  • Function
    Binds to the dendritic targeting element and may play a role in mRNA trafficking (By similarity). Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.
  • Tissue specificity
    Detected in neural and non-neural cell lines.
  • Sequence similarities
    Belongs to the KHSRP family.
    Contains 4 KH domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Cytoplasm. A small proportion is also found in the cytoplasm of neuronal cell bodies and dendrites.
  • Information by UniProt

References

ab111652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up