Human Ki67 protein fragment (ab92248)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceRKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAAD SFTS APKQTPDSGKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSN TSLPPLPFKR GGGKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVAPR ARGKSSEPVVIMKRSL RTSAKRIEPAEELNSNDMKTNKEEHKLQDSVP ENKGISLRSRRQNKTEAEQQIT EVFVLAERIEINRNEKKPMKTSPEMD IQNPDDGARKPIPRDKVTENKRCLRSAR QNESSQPKVAEESGGQKSAK VLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTL ESKSVQRVTRSVKR CAENPKKAEDNVCVKKIRTRSHRDSEDI
    • Amino acids2891 to 3256

Specifications

Our Abpromise guarantee covers the use of ab92248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 134 µl distilled water.

General info

  • Alternative names
    • Antigen identified by monoclonal antibody Ki 67
    • Antigen KI-67
    • Antigen KI67
    • KI67_HUMAN
    • KIA
    • MKI67
    • Proliferation related Ki 67 antigen
    • RP11-380J17.2
    see all
  • FunctionThought to be required for maintaining cell proliferation.
  • Sequence similaritiesContains 1 FHA domain.
  • Developmental stageExpression of this antigen occurs preferentially during late G1, S, G2 and M phases of the cell cycle, while in cells in G0 phase the antigen cannot be detected.
  • Cellular localizationNucleus. Nucleus > nucleolus. Chromosome. Predominantly localized in the G1 phase in the perinucleolar region, in the later phases it is also detected throughout the nuclear interior, being predominantly localized in the nuclear matrix. In mitosis, it is present on all chromosomes.
  • Information by UniProt

Human Ki67 protein fragment images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Human Ki67 protein fragment (ab92248)

ab92248 has not yet been referenced specifically in any publications.

Product Wall

Application ELISA

Sample: Human Recombinant protein
Blocking step: BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Type: Indirect

Other product details
Incubation time: 18 hour(s) and 0 minute(s) · Temperature: 4°C · Diluent: PBS

Primary antibody (in addition to 'Ki67 protein (Tagged-His Tag)')
Primary antibody: Abcam primary antibody: Anti-Ki67 antibody (ab66155)
Dilution: 1/10000

Secondary antibody
Name: Abcam antibody:Anti-Ki67 antibody [4A1]
Dilution: 1/10000

Additional data
Additional Notes: Primary ab in this case was the detection (ab86373) and the capture was ab66155 used at 1/1000 and 1/100.
Abcam response: This customer received an AbTrial discount to test this protein in ELISA, an untested application. The ELISA may have failed because the capture antibody ab66155 has not been tested in a sandwich assay (sELISA) with the detection antibody ab86373.
Username

Abcam user community

Verified customer

Submitted Apr 23 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"