Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKF LVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQ EKDEDGFLYMVYASQETFGF
    • Amino acids4 to 121

Specifications

Our Abpromise guarantee covers the use of ab92050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 108 µl aqua dest.

General info

  • Alternative names
    • ATG8E
    • Autophagy-related protein LC3 A
    • Autophagy-related ubiquitin-like modifier LC3 A
    • LC3
    • LC3A
    • MAP1 light chain 3 like protein 1
    • MAP1 light chain 3-like protein 1
    • MAP1A/1B light chain 3 A
    • MAP1A/MAP1B LC3 A
    • MAP1A/MAP1B light chain 3 A
    • MAP1ALC3
    • MAP1BLC3
    • Map1lc3a
    • Microtubule associated proteins 1A/1B light chain 3
    • Microtubule-associated protein 1 light chain 3 alpha
    • Microtubule-associated proteins 1A/1B light chain 3A
    • MLP3A_HUMAN
    see all
  • FunctionProbably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Tissue specificityMost abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.
  • Cellular localizationCytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Target information above from: UniProt accession Q9H492 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human MAP1LC3A protein fragment images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. A coloured control band can be seen at 15 kDa (green). The protein-specific band is blue.

References for Human MAP1LC3A protein fragment (ab92050)

ab92050 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"