Human MAP1LC3B2 full length protein (ab106858)

Overview

  • Product nameHuman MAP1LC3B2 full length protein
  • DescriptionHuman MAP1LC3B2 full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionA6NCE7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTK IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
    • Molecular weight16 kDa including tags
    • Amino acids1 to 120
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab106858 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • ATG8G
    • MAP1LC3B2
    • Microtubule associated protein 1 light chain 3 beta 2
    • Microtubule associated proteins 1A/1B light chain 3B like protein
    • Microtubule-associated proteins 1A/1B light chain 3 beta 2
    • Microtubule-associated proteins 1A/1B light chain 3B-like
    • MP3B2_HUMAN
    see all
  • FunctionProbably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Sequence similaritiesBelongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by APG4B/ATG4B to form LC3-I (By similarity). This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II.
  • Cellular localizationCytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt

Human MAP1LC3B2 full length protein images

  • 15% SDS-PAGE analysis of 3µg ab106858.

References for Human MAP1LC3B2 full length protein (ab106858)

ab106858 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"