Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIM GIYSI KKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAV SPQEEEEFRRLA ALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSR KRLPDGLTRRGDINLLMLG DPGTAKSQLLKFVEKCSPIGVYTSGKGSS AAGLTASVMRDPSSRNFIMEGGAMVL ADGGVVCIDEFDKMREDDRVAI HEAMEQQTISIAKAGITTTLNSRCSVLAAANSV FGRWDETKGEDNIDF MPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQ TQAVEGEI DLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSD R RSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAA LSGT LSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTK QKYPEHAIHKV LQLMLRRGEIQHRMQRKVLYRLK
    • Amino acids217 to 734

Specifications

Our Abpromise guarantee covers the use of ab91935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional NotesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 57 µl aqua dest.

General info

  • Alternative names
    • CDC 46
    • CDC46
    • CDC46 homolog
    • Cell division cycle 46
    • DNA replication licensing factor
    • DNA replication licensing factor MCM 5
    • DNA replication licensing factor MCM5
    • MCM 5
    • MCM5
    • MCM5_HUMAN
    • MGC5315
    • Minichromosome maintenance complex component 5
    • Minichromosome maintenance deficient (S. cerevisiae) 5
    • Minichromosome maintenance deficient 5
    • Minichromosome maintenance deficient protein 5
    • P1 CDC46
    • P1-CDC46
    see all
  • Sequence similaritiesBelongs to the MCM family.
    Contains 1 MCM domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Human MCM5 protein fragment images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Human MCM5 protein fragment (ab91935)

ab91935 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"