Human NDUFB6 full length protein (ab116994)

Overview

  • Product nameHuman NDUFB6 full length protein
  • DescriptionHuman NDUFB6 full length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO95139
    • SpeciesHuman
    • SequenceMTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKF LENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEK KSRIFPGDTILETGEVIPPMKEFPDQHH
    • Molecular weight40 kDa including tags
    • Amino acids1 to 128

Specifications

Our Abpromise guarantee covers the use of ab116994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General info

  • Alternative names
    • B17
    • CI
    • CI B17
    • CI-B17
    • Complex I mitochondrial respiratory chain B17 subunit
    • Complex I-B17
    • Complex IB17
    • MGC13675
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
    • NADH ubiquinone oxidoreductase B17 subunit
    • NADH ubiquinone oxidoreductase beta subunit 6
    • NADH-ubiquinone oxidoreductase B17 subunit
    • NDUB6_HUMAN
    • NDUFB6
    see all
  • FunctionAccessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similaritiesBelongs to the complex I NDUFB6 subunit family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Human NDUFB6 full length protein images

  • 12.5% SDS-PAGE showing ab116994 at approx. 39.82kDa.
    Stained with Coomassie Blue.

References for Human NDUFB6 full length protein (ab116994)

ab116994 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"